PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G62610.1
Common NameATMYB11, F26K9_40, MYB11, PFG2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 343aa    MW: 38313.6 Da    PI: 4.9222
Description myb domain protein 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G62610.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.11.3e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEd  l d+++  G g+W++ ++  g++R++k+c++rw +yl
      AT3G62610.1 14 KGRWTAEEDRTLSDYIQSNGEGSWRSLPKNAGLKRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.88.9e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE++ +v+++  lG++ W+tIa+ ++ gRt++++k++w+++l
      AT3G62610.1  67 RGNITPEEEDVIVKLHSTLGTR-WSTIASNLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.593961IPR017930Myb domain
SuperFamilySSF466891.61E-2711108IPR009057Homeodomain-like
SMARTSM007172.1E-111363IPR001005SANT/Myb domain
PfamPF002497.7E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-211568IPR009057Homeodomain-like
CDDcd001672.40E-81661No hitNo description
PROSITE profilePS5129424.66962116IPR017930Myb domain
SMARTSM007173.0E-1566114IPR001005SANT/Myb domain
PfamPF002492.2E-1467112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.9E-2569116IPR009057Homeodomain-like
CDDcd001672.71E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051555Biological Processflavonol biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MGRAPCCEKV GIKKGRWTAE EDRTLSDYIQ SNGEGSWRSL PKNAGLKRCG KSCRLRWINY  60
LRSDIKRGNI TPEEEDVIVK LHSTLGTRWS TIASNLPGRT DNEIKNYWNS HLSRKLHGYF  120
RKPTVANTVE NAPPPPKRRP GRTSRSAMKP KFILNPKNHK TPNSFKANKS DIVLPTTTIE  180
NGEGDKEDAL MVLSSSSLSG AEEPGLGPCG YGDDGDCNPS INGDDGALCL NDDIFDSCFL  240
LDDSHAVHVS SCESNNVKNS EPYGGMSVGH KNIETMADDF VDWDFVWREG QTLWDEKEDL  300
DSVLSRLLDG EEMESEIRQR DSNDFGEPLD IDEENKMAAW LLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-231211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.472050.0flower| seed| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306956310.0
Genevisible251223_at0.0
Expression AtlasAT3G62610-
AtGenExpressAT3G62610-
ATTED-IIAT3G62610-
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
Function -- GeneRIF ? help Back to Top
  1. These findings indicate that AtMYB11 modulates overall growth in plants by reducing the proliferation activity of meristematic cells and delaying plant development.
    [PMID: 18359753]
  2. AtMYB11 enhances flavonol and chlorogenic acid (CGA) biosynthesis in tobacco through up-regulation of the biosynthetic genes.
    [PMID: 25981047]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G62610.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G62610
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196020.0AY519602.1 Arabidopsis thaliana MYB transcription factor (At3g62610) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_191820.10.0myb domain protein 11
SwissprotO222641e-114MYB12_ARATH; Transcription factor MYB12
TrEMBLQ9LZK40.0Q9LZK4_ARATH; Myb domain protein 11
STRINGAT3G62610.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Ma S,Gong Q,Bohnert HJ
    Dissecting salt stress pathways.
    J. Exp. Bot., 2006. 57(5): p. 1097-107
    [PMID:16510518]
  5. Osuna D, et al.
    Temporal responses of transcripts, enzyme activities and metabolites after adding sucrose to carbon-deprived Arabidopsis seedlings.
    Plant J., 2007. 49(3): p. 463-91
    [PMID:17217462]
  6. Stracke R, et al.
    Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.
    Plant J., 2007. 50(4): p. 660-77
    [PMID:17419845]
  7. Petroni K, et al.
    The AtMYB11 gene from Arabidopsis is expressed in meristematic cells and modulates growth in planta and organogenesis in vitro.
    J. Exp. Bot., 2008. 59(6): p. 1201-13
    [PMID:18359753]
  8. Yonekura-Sakakibara K, et al.
    Comprehensive flavonol profiling and transcriptome coexpression analysis leading to decoding gene-metabolite correlations in Arabidopsis.
    Plant Cell, 2008. 20(8): p. 2160-76
    [PMID:18757557]
  9. Stracke R, et al.
    Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.
    New Phytol., 2010. 188(4): p. 985-1000
    [PMID:20731781]
  10. Pandey A,Misra P,Trivedi PK
    Constitutive expression of Arabidopsis MYB transcription factor, AtMYB11, in tobacco modulates flavonoid biosynthesis in favor of flavonol accumulation.
    Plant Cell Rep., 2015. 34(9): p. 1515-28
    [PMID:25981047]
  11. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]